General Information

  • ID:  hor004725
  • Uniprot ID:  A7REH2
  • Protein name:  Protein RALF-like 30
  • Gene name:  RALFL30
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant rapid alkalinization factor (RALF) family
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007267 cell-cell signaling; GO:0019722 calcium-mediated signaling
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  AGGGKFLNPGVLDPCLRPNPPPECQAPGSAGKPRERVNEYKVGCSKLTRCDRVG
  • Length:  54(23-76)
  • Propeptide:  MKAWVICLMVISIFMMIEPTLAAGGGKFLNPGVLDPCLRPNPPPECQAPGSAGKPRERVNEYKVGCSKLTRCDRVG
  • Signal peptide:  MKAWVICLMVISIFMMIEPTLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling event
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  15-24; 44-50
  • Structure ID:  AF-A7REH2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004725_AF2.pdbhor004725_ESM.pdb

Physical Information

Mass: 663906 Formula: C243H397N77O73S4
Absent amino acids: HIMW Common amino acids: GP
pI: 9.04 Basic residues: 9
Polar residues: 19 Hydrophobic residues: 12
Hydrophobicity: -72.22 Boman Index: -11275
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 55.93
Instability Index: 3322.59 Extinction Coefficient cystines: 1740
Absorbance 280nm: 32.83

Literature

  • PubMed ID:  12611624
  • Title:  Peptomics, Identification of Novel Cationic Arabidopsis Peptides with Conserved Sequence Motifs.